PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32085
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 296aa    MW: 33469.5 Da    PI: 7.6124
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32085genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.51.1e-3651105660
                     zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                 +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Tp57577_TGAC_v2_mRNA32085  51 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 105
                                58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-224896IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67751105IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3151105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MCFGNSNFTN NKLVLFGKIL GPHIEEIEGD NIFCHTDADM ESEWKANEIS PNCPRCGSSN  60
TKFCYYNNYS LTQPRYFCKG CRRYWTKGGS LRNVPVGGGC RKNRRGNNKT LLRQQSFDSL  120
TFKNSDTIGH HSYDPILRTN NIISSSSCSS LVNTDRPNID LALVYANFLN KKPDSQNNSD  180
QMDKRPFDPS LENSRLSNVE VGTSSFNLSE IEIGLKGCLN LNQEQLPSTI TNFSEVENNQ  240
MYCNEFHSME ILQNIQLKEI YNTRLEKRAS TGNKLCATHD PINPTIGFES IKQMH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467842.11e-102Dof domain zinc finger protein
TrEMBLA0A072VIR11e-102A0A072VIR1_MEDTR; Dof domain zinc finger protein
STRINGGLYMA02G35296.11e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-35Dof family protein